CATH Domain: 1dv5A00 XML data for domain: 1dv5A00

Molscript image for 1dv5A00
1dv5A00
PDB coordinates for domain 1dv5A00

PDB 1dv5, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1200 Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
1.10.1200.10 Gene3D
1.10.1200.10.3
1.10.1200.10.3.1
1.10.1200.10.3.1.1
1.10.1200.10.3.1.1.1
1.10.1200.10.3.1.1.1.1

[top]
Segment boundaries for domain 1dv5A00

Chopping figure for domain 1dv5A00
DomainStart PDB ResidueStop PDB Residue
1dv5A00 2 81

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.10.1200.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1dnyA00 83.34 Brevibacillus parabrevisTyrocidine synthase 3 1.10.1200.10 76 13 91 3.20 3.51
2avaA00 82.88 Spinacia oleraceaAcyl carrier protein 1, chloroplastic 1.10.1200.10 82 17 93 4.14 4.41
1or5A00 82.39 Streptomyces roseofulvusAcyl carrier protein 1.10.1200.10 82 18 92 2.92 3.15
2cnrA00 81.41 Acyl carrier proteinAcyl carrier proteinStreptomyces coelicolor 1.10.1200.10 82 18 93 3.05 3.25
2bl0B01 80.01 Physarum polycephalumMyosin regulatory light chain 1.10.238.10 68 5 77 3.34 4.31
2jq4A00 79.99 Agrobacterium tumefaciens str. C58Acyl carrier protein, putative 1.10.1200.10 83 20 90 3.25 3.60
1a4pA00 76.76 Protein S100-A10Homo sapiens 1.10.238.10 92 7 70 3.21 4.54
1klpA00 73.88 Meromycolate extension acyl carrier proteinAcyl carrier proteinMycobacterium tuberculosis 1.10.1200.10 115 12 66 3.17 4.73
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1dv5A00
ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1dv5A00
ADEAIKNGVLDILADLTGSDDVKKNLDLNLFETGLLDSMGTVQLLLELQSQFGVDAPVSEFDRKEWDTPNKIIAKVEQAQ
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"