CATH Domain: 1dtxA00 XML data for domain: 1dtxA00

Molscript image for 1dtxA00
1dtxA00
PDB coordinates for domain 1dtxA00

PDB 1dtx, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.410 Factor Xa Inhibitor
4.10.410.10 Factor Xa Inhibitor Gene3D
4.10.410.10.5
4.10.410.10.5.1
4.10.410.10.5.1.1
4.10.410.10.5.1.1.1
4.10.410.10.5.1.1.1.1

[top]
Segment boundaries for domain 1dtxA00

Chopping figure for domain 1dtxA00
DomainStart PDB ResidueStop PDB Residue
1dtxA00 2 59

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 4.10.410.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1y62A00 94.71 Conkunitzin-S1Conus striatus 4.10.410.10 56 42 96 0.77 0.80
1bunB00 89.74 Bungarus multicinctusBeta-bungarotoxin B2 chain 4.10.410.10 61 34 95 2.14 2.25
1tocR02 88.44 OrnithodorinOrnithodoros moubata 4.10.410.10 58 18 93 2.24 2.41
1tocR01 82.95 OrnithodorinOrnithodoros moubata 4.10.410.10 52 7 84 2.75 3.26
1bikA00 81.73 Protein homodimerization activityPlasma membraneNegative regulation of JNK cascadeSerine-type endopeptidase inhibitor activityIgA binding 4.10.410.10 110 31 52 2.08 3.94
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1dtxA00
PRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1dtxA00
XPRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1dtx000" to "1dtxA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"