CATH Domain: 1dt9A02 XML data for domain: 1dt9A02

Molscript image for 1dt9A02
1dt9A02
PDB coordinates for domain 1dt9A02

PDB 1dt9, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.60 Gene3D
3.30.420.60.1
3.30.420.60.1.1
3.30.420.60.1.1.1
3.30.420.60.1.1.1.1
3.30.420.60.1.1.1.1.1

[top]
Segment boundaries for domain 1dt9A02

Chopping figure for domain 1dt9A02
DomainStart PDB ResidueStop PDB Residue
1dt9A01 28 132
1dt9A02 143 174
1dt9A02 198 277
1dt9A03 278 422

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.420.60.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ewqA02 77.54 Thermus aquaticusDNA mismatch repair protein mutS 3.30.420.110 117 8 81 3.15 3.88
1nu0A00 75.94 Putative holliday junction resolvase [EC:3.1.-.-]Putative Holliday junction resolvaseEscherichia coli K-12 3.30.420.140 127 7 79 3.21 4.04
1vhxB00 75.46 Bacillus subtilisPutative holliday junction resolvase [EC:3.1.-.-]Putative Holliday junction resolvase 3.30.420.140 132 5 75 3.51 4.63
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1dt9A02
DSKFGFIVIDGSGALFGTLQGNTREVLHKFTVRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQR
LQSKVLKLVDISYGGENGFNQAIELSTEVLSN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1dt9A02
DSKFGFIVIDGSGALFGTLQGNTREVLHKFTVRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSDMFDQR
LQSKVLKLVDISYGGENGFNQAIELSTEVLSN
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:23

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"