CATH Domain: 1dq3A02 XML data for domain: 1dq3A02

Molscript image for 1dq3A02
1dq3A02
PDB coordinates for domain 1dq3A02

PDB 1dq3, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.160 Double Stranded RNA Binding Domain
3.30.160.90 Gene3D
3.30.160.90.1
3.30.160.90.1.1
3.30.160.90.1.1.1
3.30.160.90.1.1.1.1
3.30.160.90.1.1.1.1.1

Segment boundaries for domain 1dq3A02

Chopping figure for domain 1dq3A02
DomainStart PDB ResidueStop PDB Residue
1dq3A01 1 137
1dq3A01 415 454
1dq3A02 339 414
1dq3A03 138 224
1dq3A04 225 338

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.160.90.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1whzA00 80.11 Hypothetical proteinThermus thermophilus HB8Putative uncharacterized protein TTHA1913 3.30.920.30 67 13 88 3.63 4.12
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|1dq3A02
GLPLNFNAFKEWASEYGVEFKTNGSQTIAIINDERISLGQWHTRNRVSKAVLVKMLRKLYEATKDEEVKRMLHLIE    

Domain COMBS Sequence

>pdb|1dq3A02
GLPLNFNAFKEWASEYGVEFKTNGSQTIAIINDERISLGQWHTRNRVSKAVLVKMLRKLYEATKDEEVKRMLHLIE    

Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:22

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"