Set cath from cathlist by auto on 05 Mar 2006 18:49
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1dq3A01 | 1 | 137 |
| 1dq3A01 | 415 | 454 |
| 1dq3A02 | 339 | 414 |
| 1dq3A03 | 138 | 224 |
| 1dq3A04 | 225 | 338 |
There are 2 matching structural neighberhood comparisons for CATH ID 2.170.16.10.2.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1mi8A00 | 85.25 | 2.170.16.10 | 141 | 19 | 77 | 2.29 | 2.96 | |
![]() |
1at0A00 | 83.37 | 2.170.16.10 | 142 | 11 | 76 | 2.49 | 3.26 |
>pdb|1dq3A01 CIDGKAKIIFENEGEEHLTTMEEMYERYKHLGEFYDEEYNRWGIDVSNVPIYVKSFDPESKRVVKGKVNVIWKYELGKDV TKYEIITNKGTKILTSPWHPFFVLTPDFKIVEKRADELKEGDILIGGMPDGEDYKFIGLEVVRHITTTNEPRTFYDLTVE NYQNYLAGENGMIFVHN
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"