CATH Domain: 1dptA00 XML data for domain: 1dptA00

Molscript image for 1dptA00
1dptA00
PDB coordinates for domain 1dptA00

PDB 1dpt, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.429 Macrophage Migration Inhibitory Factor
3.30.429.10 Macrophage Migration Inhibitory Factor Gene3D
3.30.429.10.2
3.30.429.10.2.1
3.30.429.10.2.1.1
3.30.429.10.2.1.1.1
3.30.429.10.2.1.1.1.1

[top]
Segment boundaries for domain 1dptA00

Chopping figure for domain 1dptA00
DomainStart PDB ResidueStop PDB Residue
1dptA00 1 117

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.429.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2xczA00 91.07 Possible ATLS1-like light-inducible proteinProchlorococcus marinus str. MIT 9313 3.30.429.10 114 26 97 1.79 1.84
1mwwB00 84.71 Haemophilus influenzaeUncharacterized protein HI_1388.1 3.30.429.10 118 7 96 2.65 2.74
1u9dA00 83.33 Vibrio choleraePutative uncharacterized protein 3.30.429.10 120 11 87 2.76 3.15
3e6qA00 82.74 Tyrosine metabolismPseudomonas aeruginosa5-carboxymethyl-2-hydroxymuconate isomerase [EC:5.3.3.10]Benzoate degradation via hydroxylationPutative uncharacterized protein 3.30.429.10 120 9 90 3.72 4.10
3c6vA00 79.07 Aspergillus fumigatusPutative uncharacterized protein 3.30.429.10 140 14 80 3.49 4.32
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1dptA00
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHF
FEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1dptA00
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHF
FEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"