CATH Domain: 1dnyA00 XML data for domain: 1dnyA00

Molscript image for 1dnyA00
1dnyA00
PDB coordinates for domain 1dnyA00

PDB 1dny, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1200 Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
1.10.1200.10 Gene3D
1.10.1200.10.8
1.10.1200.10.8.1
1.10.1200.10.8.1.1
1.10.1200.10.8.1.1.1
1.10.1200.10.8.1.1.1.1

[top]
Segment boundaries for domain 1dnyA00

Chopping figure for domain 1dnyA00
DomainStart PDB ResidueStop PDB Residue
1dnyA00 8 83

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.1200.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wdcC01 76.80 Myosin essential light chain, striated adductor muscleArgopecten irradians 1.10.238.10 78 9 76 3.75 4.88
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1dnyA00
YVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQYVAT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1dnyA00
MPVTEAQYVAPTNAVESKLAEIWERVLGVSGIGILDNFFQIGGHSLKAMAVAAQVHREYQVELPLKVLFAQPTIKALAQY
VATRSHHHHHH
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"