CATH Domain: 1dljA03 XML data for domain: 1dljA03

Molscript image for 1dljA03
1dljA03
PDB coordinates for domain 1dljA03

PDB 1dlj, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1040 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2
1.10.1040.10 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 Gene3D
1.10.1040.10.10
1.10.1040.10.10.1
1.10.1040.10.10.1.1
1.10.1040.10.10.1.1.1
1.10.1040.10.10.1.1.1.1

[top]
Segment boundaries for domain 1dljA03

Chopping figure for domain 1dljA03
DomainStart PDB ResidueStop PDB Residue
1dljA01 1 204
1dljA02 295 402
1dljA03 205 294

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.1040.10.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1i36A02 81.88 Methanothermobacter thermautotrophicus str. Delta HConserved protein 1.10.1040.10 99 13 89 4.12 4.58
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1dljA03
LFANTYLALRVAYFNELDTYAESRKLNSHMIIQGISYDDRIGMHYNNPSFGYGGYSLPKDTKQLLANYNNIPQTLIEAIV
SSNNVRKSYI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1dljA03
LFANTYLALRVAYFNELDTYAESRKLNSHMIIQGISYDDRIGMHYNNPSFGYGGYSLPKDTKQLLANYNNIPQTLIEAIV
SSNNVRKSYI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:21

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"