CATH Domain: 1dhnA00 XML data for domain: 1dhnA00

Molscript image for 1dhnA00
1dhnA00
PDB coordinates for domain 1dhnA00

PDB 1dhn, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1130 GTP Cyclohydrolase I, domain 2
3.30.1130.10 Gene3D
3.30.1130.10.4
3.30.1130.10.4.1
3.30.1130.10.4.1.1
3.30.1130.10.4.1.1.1
3.30.1130.10.4.1.1.1.1

[top]
Segment boundaries for domain 1dhnA00

Chopping figure for domain 1dhnA00
DomainStart PDB ResidueStop PDB Residue
1dhnA00 1 121

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.1130.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nbuA00 94.00 Folate biosynthesisMetabolic pathwaysDihydroneopterin aldolase [EC:4.1.2.25]Mycobacterium tuberculosisProbable dihydroneopterin aldolase 3.30.1130.10 118 33 97 0.85 0.87
1b9lA00 88.22 Folic acid-containing compound metabolic processDihydroneopterin triphosphate 2'-epimerase activityD-erythro-7,8-dihydroneopterin triphosphate epimerase [EC:5.-.-.-]D-erythro-7,8-dihydroneopterin triphosphate epimeraseProtein binding 3.30.1130.10 119 19 96 1.96 2.03
3d7jC00 81.39 Putative uncharacterized protein SCO6650Streptomyces coelicolor 3.30.479.10 133 16 75 2.60 3.42
2g64A00 77.95 Caenorhabditis elegansIdentical protein binding6-pyruvoyl tetrahydrobiopterin synthase [EC:4.2.3.12]Putative 6-pyruvoyl tetrahydrobiopterin synthaseFolate biosynthesis 3.30.479.10 127 12 78 3.12 3.96
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1dhnA00
MQDTIFLKGMRFYGYHGALSAENEIGQIFKVDVTLKVDLSEAGRTDNVIDTVHYGEVFEEVKSIMEGKAVNLLEHLAERI
ANRINSQYNRVMETKVRITKENPPIPGHYDGVGIEIVRENK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1dhnA00
MQDTIFLKGMRFYGYHGALSAENEIGQIFKVDVTLKVDLSEAGRTDNVIDTVHYGEVFEEVKSIMEGKAVNLLEHLAERI
ANRINSQYNRVMETKVRITKENPPIPGHYDGVGIEIVRENK
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1dhn000" to "1dhnA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:32

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"