Set cath from cathlist by auto on 05 Mar 2006 18:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1dgsA01 | 1 | 76 |
| 1dgsA02 | 84 | 118 |
| 1dgsA02 | 251 | 310 |
| 1dgsA03 | 119 | 250 |
| 1dgsA04 | 317 | 389 |
| 1dgsA05 | 430 | 498 |
| 1dgsA06 | 499 | 581 |
There are 11 matching structural neighberhood comparisons for CATH ID 1.10.150.20.16.1.1.1.1 (SIMAX score < 5)
>pdb|1dgsA06 KHRGLERLLYALGLPGVGEVLARNLARRFGTMDRLLEASLEELIEVEEVGELTARAILETLKDPAFRDLVRRLKEAGVSM ESK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"