CATH Domain: 1dgnA00 XML data for domain: 1dgnA00

Molscript image for 1dgnA00
1dgnA00
PDB coordinates for domain 1dgnA00

PDB 1dgn, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.533 Death Domain, Fas
1.10.533.10 Death Domain, Fas Gene3D
1.10.533.10.10
1.10.533.10.10.1
1.10.533.10.10.1.1
1.10.533.10.10.1.1.1
1.10.533.10.10.1.1.1.1

[top]
Segment boundaries for domain 1dgnA00

Chopping figure for domain 1dgnA00
DomainStart PDB ResidueStop PDB Residue
1dgnA00 2 90

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 1.10.533.10.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ngrA00 80.27 Negative regulation of muscle organ developmentRattus norvegicusNucleusNeurotrophin signaling pathwayTumor necrosis factor receptor superfamily member 16 1.10.533.10 85 12 89 3.32 3.69
1ichA00 79.62 Integral to plasma membraneChagas diseaseTumor necrosis factor receptor superfamily member 1AAlzheimer's diseasePositive regulation of I-kappaB kinase/NF-kappaB cascade 1.10.533.10 87 4 89 3.52 3.92
1a1wA00 75.42 FAS (TNFRSF6)-associated via death domainIdentical protein bindingPathways in cancerChagas diseaseAlzheimer's disease 1.10.533.10 83 10 82 3.40 4.15
1n3kA00 73.71 Astrocytic phosphoprotein PEA-15Cricetulus griseus 1.10.533.10 130 7 60 2.99 4.98
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1dgnA00
ADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDP
QLASKMGLH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1dgnA00
ADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDP
QLASKMGLH
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:34

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"