CATH Domain: 1df7A00 XML data for domain: 1df7A00

Molscript image for 1df7A00
1df7A00
PDB coordinates for domain 1df7A00

PDB 1df7, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.430 Dihydrofolate Reductase, subunit A
3.40.430.10 Dihydrofolate Reductase, subunit A Gene3D
3.40.430.10.2
3.40.430.10.2.1
3.40.430.10.2.1.2
3.40.430.10.2.1.2.1
3.40.430.10.2.1.2.1.1

[top]
Segment boundaries for domain 1df7A00

Chopping figure for domain 1df7A00
DomainStart PDB ResidueStop PDB Residue
1df7A00 1 159

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.40.430.10.2.1.2.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3dauA00 90.98 One carbon pool by folateFolate biosynthesisMetabolic pathwaysDihydrofolate reductaseDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 159 33 94 1.44 1.52
3dfrA00 89.69 One carbon pool by folateLactobacillus caseiDihydrofolate reductaseFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 162 31 95 1.70 1.79
3ix9A00 89.60 One carbon pool by folateDihydrofolate reductaseFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3]Metabolic pathways 3.40.430.10 166 25 95 1.78 1.87
2w9hA00 89.12 One carbon pool by folateFolate biosynthesisMetabolic pathwaysDihydrofolate reductaseDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 157 28 93 1.69 1.81
1qzfA01 87.71 Pyrimidine metabolismThymidylate synthase [EC:2.1.1.45]One carbon pool by folateBifunctional dihydrofolate reductase-thymidylate synthaseFolate biosynthesis 3.40.430.10 176 28 90 1.99 2.20
1cz3B00 87.22 Thermotoga maritimaDihydrofolate reductase 3.40.430.10 168 25 90 2.70 2.98
1vdrA00 87.19 One carbon pool by folateDihydrofolate reductaseHaloferax volcaniiFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 157 29 90 1.75 1.93
1aoeA00 85.58 Dihydrofolate reductaseCandida albicans 3.40.430.10 192 29 83 2.52 3.02
2fziA00 85.22 Pneumocystis cariniiDihydrofolate reductase 3.40.430.10 206 35 77 1.97 2.54
2bl9A00 84.63 Bifunctional dihydrofolate reductase-thymidylate synthasePlasmodium vivax 3.40.430.10 216 26 74 1.80 2.43
1juvA00 82.59 Dihydrofolate reductaseEnterobacteria phage T4 3.40.430.10 193 25 81 2.81 3.43
2hxvA02 81.61 Riboflavin metabolismMetabolic pathwaysThermotoga maritimaDiaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]Riboflavin-specific deaminase 3.40.430.10 193 14 76 2.80 3.65
2p4gA00 77.85 Corynebacterium diphtheriaePutative uncharacterized protein 3.40.430.10 244 14 63 2.79 4.42
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1df7A00
MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLPGRRNVVLSRQADFMASGAEVVG
SLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIGLPREAGDALAPVLDETWRGETGEWRFSRSGLRYRLYSYHRS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1df7A00
MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPAKVRPLPGRRNVVLSRQADFMASGAEVVG
SLEEALTSPETWVIGGGQVYALALPYATRCEVTEVDIGLPREAGDALAPVLDETWRGETGEWRFSRSGLRYRLYSYHRS
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"