Set cath from cathlist by auto on 05 Mar 2006 18:29
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ddgA01 | 226 | 279 |
| 1ddgA01 | 385 | 444 |
| 1ddgA02 | 280 | 384 |
| 1ddgA03 | 445 | 599 |
There are 10 matching structural neighberhood comparisons for CATH ID 2.40.30.10.11.1.1.1.1 (SIMAX score < 5)
>pdb|1ddgA01 IHTSPYSKDAPLVASLSVNQKITGRNSEKDVRHIEIDLGDSGLRYQPGDALGVWPRLYSIASSQAEVENEVHVTVGVVRY DVEGRARAGGASSFLADRVEEEGEVRVFIEHNDN
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"