CATH Domain: 1dd9A02 XML data for domain: 1dd9A02

Molscript image for 1dd9A02
1dd9A02
PDB coordinates for domain 1dd9A02

PDB 1dd9, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1360 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2
3.40.1360.10 Gene3D
3.40.1360.10.1
3.40.1360.10.1.1
3.40.1360.10.1.1.1
3.40.1360.10.1.1.1.1
3.40.1360.10.1.1.1.1.1

[top]
Segment boundaries for domain 1dd9A02

Chopping figure for domain 1dd9A02
DomainStart PDB ResidueStop PDB Residue
1dd9A01 115 240
1dd9A02 241 367
1dd9A03 368 426

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.1360.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1q57G02 83.39 Enterobacteria phage T7DNA primase/helicase 3.40.1360.10 126 19 91 2.54 2.78
1gkuB05 77.22 Reverse gyraseReverse gyrase [EC:5.99.1.3 3.6.1.-]Archaeoglobus fulgidus 3.40.50.140 121 10 75 3.32 4.40
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1dd9A02
KGRQLYGLYEAQQDNAEPNRLLVVEGYMDVVALAQYGINYAVASLGSTTADHIQLLFRATNNVICCYDGDRAGRDAAWRA
LETALPYMTDGRQLRFMFLPDGEDPDTLVRKEGKEAFEARMEQAMP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1dd9A02
KGRQLYGLYEAQQDNAEPNRLLVVEGYMDVVALAQYGINYAVASLGTSTTADHIQLLFRATNNVICCYDGDRAGRDAAWR
ALETALPYMTDGRQLRFMFLPDGEDPDTLVRKEGKEAFEARMEQAMP
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:20

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"