Set cath from cathlist by auto on 05 Mar 2006 19:34
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1dciA01 | 53 | 264 |
| 1dciA02 | 265 | 327 |
There are 10 matching structural neighberhood comparisons for CATH ID 3.90.226.10.2.1.1.1.1 (SIMAX score < 5)
>pdb|1dciA01 AYESIQVTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMASDILQPPGD DVARIAWYLRDLISRYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGLAADVGTLQRLP KVIGNRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVMLNAAFALAADIS
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"