Set cath from cathlist by auto on 05 Mar 2006 19:32
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1dceA01 | 2 | 241 |
| 1dceA01 | 353 | 429 |
| 1dceA02 | 242 | 344 |
| 1dceA03 | 431 | 566 |
There are 3 matching structural neighberhood comparisons for CATH ID 3.80.10.10.16.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1w8aA00 | 80.00 | 3.80.10.10 | 189 | 19 | 66 | 2.65 | 3.98 | |
![]() |
2ifgA01 | 79.72 | 3.80.10.10 | 156 | 19 | 83 | 3.81 | 4.57 | |
![]() |
1fo1B00 | 79.10 | 3.80.10.10 | 163 | 19 | 68 | 3.13 | 4.56 |
>pdb|1dceA03 LENSVLKMEYADVRVLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGVANLPRL QELLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSVSSIL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"