Set cath from cathlist by auto on 05 Mar 2006 18:24
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1dbhA01 | 198 | 421 |
| 1dbhA02 | 423 | 550 |
There are 13 matching structural neighberhood comparisons for CATH ID 2.30.29.30.23.1.1.1.1 (SIMAX score < 5)
>pdb|1dbhA02 NEIQKNIDGWEGKDIGQCCNEFIEGTLTRVGAKHERHIFLFDGLICCKSNHGQPRLPGASNAEYRLKEKFFRKVQINDKD DTNEYKHAFEIILKDENSVIFSAKSAEEKNNWAALISLQYRSTL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"