CATH Domain: 1daqA00 XML data for domain: 1daqA00

Molscript image for 1daqA00
1daqA00
PDB coordinates for domain 1daqA00

PDB 1daq, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1330 Type 1 dockerin domain
1.10.1330.10 Type 1 dockerin domain Gene3D
1.10.1330.10.1
1.10.1330.10.1.1
1.10.1330.10.1.1.1
1.10.1330.10.1.1.1.1
1.10.1330.10.1.1.1.1.1

[top]
Segment boundaries for domain 1daqA00

Chopping figure for domain 1daqA00
DomainStart PDB ResidueStop PDB Residue
1daqA00 1 71

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1daqA00
MSTKLYGDVNDDGKVNSTDAVALKRYVLRSGISINTDNADLNEDGRVNSTDLGILKRYILKEIDTLPYKNG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1daqA00
MSTKLYGDVNDDGKVNSTDAVALKRYVLRSGISINTDNADLNEDGRVNSTDLGILKRYILKEIDTLPYKNG
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:16

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:38

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"