Set cath from cathlist by auto on 05 Mar 2006 18:29
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1d7kB01 | 35 | 45 |
| 1d7kB01 | 280 | 409 |
| 1d7kB02 | 46 | 279 |
There are 3 matching structural neighberhood comparisons for CATH ID 2.40.37.10.6.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2p3eA01 | 81.91 | 2.40.37.10 | 175 | 17 | 69 | 2.39 | 3.46 | |
![]() |
1knwA01 | 81.29 | 2.40.37.10 | 176 | 15 | 68 | 2.65 | 3.85 | |
![]() |
2o0tA01 | 81.05 | 2.40.37.10 | 185 | 18 | 68 | 3.09 | 4.50 |
>pdb|1d7kB01 DDKDAFYVADLVASAFTLAVNIIAKKIVLKEQSSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDERYYSSSIW GPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVM
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"