CATH Domain: 1d5tA01 XML data for domain: 1d5tA01

Molscript image for 1d5tA01
1d5tA01
PDB coordinates for domain 1d5tA01

PDB 1d5t, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.50 3-Layer(bba) Sandwich
3.50.50 FAD/NAD(P)-binding domain
3.50.50.60 Gene3D
3.50.50.60.1
3.50.50.60.1.1
3.50.50.60.1.1.1
3.50.50.60.1.1.1.1
3.50.50.60.1.1.1.1.1

[top]
Segment boundaries for domain 1d5tA01

Chopping figure for domain 1d5tA01
DomainStart PDB ResidueStop PDB Residue
1d5tA01 -2 57
1d5tA01 224 294
1d5tA01 387 431
1d5tA02 58 118
1d5tA02 295 386
1d5tA03 119 223

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.50.50.60.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vg0A01 85.29 Rattus norvegicusRab GTPase bindingRab proteins geranylgeranyltransferase component A 1 3.50.50.60 205 29 84 2.82 3.34
1s3eA01 79.89 Tyrosine metabolismAmine oxidase [flavin-containing] BArginine and proline metabolismGlycine, serine and threonine metabolismHistidine metabolism 3.50.50.60 195 12 76 3.49 4.57
1nhpA01 77.62 NADH peroxidaseNADH peroxidase [EC:1.11.1.1]Enterococcus faecalis 3.50.50.60 167 11 75 3.70 4.91
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1d5tA01
HHMDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQYLYPLYGLGELPQGFARLSAI
YGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYVPDRVRKAYEPIDDGSESQVFCSCSYDATTHFETTCND
IKDIYKRMAGSAFDF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1d5tA01
HHMDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQYLYPLYGLGELPQGFARLSAI
YGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYVPDRVRKAYEPIDDGSESQVFCSCSYDATTHFETTCND
IKDIYKRMAGSAFDF
BLAST against CATH

[top]
Domain History Events (135)

Domain assigned by lewis on 19 Jan 2007 16:21

Assigning domain 1d5tA01 to 3.50.50.60 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to an old domain (from the previous chopping) which was in 3.50.50.60 at the time the chain was unchopped.

Update comment by auto on 19 Jan 2007 07:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 19 Jan 2007 03:42

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 18 Jan 2007 23:36

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 18 Jan 2007 19:51

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 18 Jan 2007 15:46

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 18 Jan 2007 11:40

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 18 Jan 2007 07:33

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 18 Jan 2007 03:33

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 17 Jan 2007 23:34

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 17 Jan 2007 19:40

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 17 Jan 2007 15:46

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 17 Jan 2007 11:48

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 17 Jan 2007 07:37

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 17 Jan 2007 03:36

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 16 Jan 2007 23:40

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 16 Jan 2007 19:36

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 16 Jan 2007 15:44

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 16 Jan 2007 11:43

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 16 Jan 2007 07:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 16 Jan 2007 03:34

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 15 Jan 2007 23:26

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 15 Jan 2007 19:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 15 Jan 2007 15:35

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 15 Jan 2007 11:41

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 15 Jan 2007 07:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 15 Jan 2007 03:31

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 14 Jan 2007 23:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 14 Jan 2007 19:33

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 14 Jan 2007 15:35

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 14 Jan 2007 11:39

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 14 Jan 2007 07:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 14 Jan 2007 03:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 13 Jan 2007 23:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 13 Jan 2007 19:31

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 13 Jan 2007 15:45

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 13 Jan 2007 11:39

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 13 Jan 2007 07:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 13 Jan 2007 03:42

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 12 Jan 2007 23:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 12 Jan 2007 19:33

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 12 Jan 2007 15:41

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 12 Jan 2007 11:41

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 12 Jan 2007 07:33

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 12 Jan 2007 03:35

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 11 Jan 2007 23:37

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 11 Jan 2007 19:33

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 11 Jan 2007 15:43

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 11 Jan 2007 11:48

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 11 Jan 2007 07:36

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 11 Jan 2007 03:35

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 10 Jan 2007 23:40

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 10 Jan 2007 19:35

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 10 Jan 2007 15:43

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 10 Jan 2007 11:50

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 10 Jan 2007 07:37

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 10 Jan 2007 03:36

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 09 Jan 2007 23:33

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 09 Jan 2007 19:34

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 09 Jan 2007 15:39

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 09 Jan 2007 11:44

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 09 Jan 2007 07:37

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 09 Jan 2007 03:38

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 08 Jan 2007 23:41

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 08 Jan 2007 20:17

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 08 Jan 2007 15:36

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 08 Jan 2007 11:38

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 08 Jan 2007 07:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 08 Jan 2007 03:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 07 Jan 2007 23:26

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 07 Jan 2007 19:31

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 07 Jan 2007 15:42

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 07 Jan 2007 11:43

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 07 Jan 2007 07:34

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 07 Jan 2007 03:46

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 06 Jan 2007 23:41

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 30 Dec 2006 15:28

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 30 Dec 2006 11:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 30 Dec 2006 07:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 30 Dec 2006 03:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 29 Dec 2006 23:25

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 29 Dec 2006 19:28

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 29 Dec 2006 15:28

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 29 Dec 2006 11:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 29 Dec 2006 07:29

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 29 Dec 2006 03:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 28 Dec 2006 23:25

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 28 Dec 2006 19:28

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 28 Dec 2006 15:28

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 28 Dec 2006 11:26

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 28 Dec 2006 07:29

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 28 Dec 2006 03:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 27 Dec 2006 23:24

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 27 Dec 2006 19:28

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 27 Dec 2006 15:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 27 Dec 2006 11:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 27 Dec 2006 07:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 27 Dec 2006 03:31

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 26 Dec 2006 23:25

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 26 Dec 2006 19:31

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 26 Dec 2006 15:29

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 26 Dec 2006 11:27

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 26 Dec 2006 07:33

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 26 Dec 2006 03:33

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 25 Dec 2006 23:27

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 25 Dec 2006 19:31

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 25 Dec 2006 15:29

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 25 Dec 2006 11:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 25 Dec 2006 07:31

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 25 Dec 2006 03:31

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 24 Dec 2006 23:33

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 24 Dec 2006 19:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 24 Dec 2006 15:32

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 24 Dec 2006 11:27

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 24 Dec 2006 07:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 24 Dec 2006 03:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 23 Dec 2006 23:34

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 23 Dec 2006 19:29

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 23 Dec 2006 15:29

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 23 Dec 2006 11:29

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 23 Dec 2006 07:30

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 23 Dec 2006 03:34

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 22 Dec 2006 23:31

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 22 Dec 2006 19:34

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 22 Dec 2006 15:44

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 22 Dec 2006 11:41

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 22 Dec 2006 07:36

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 22 Dec 2006 03:40

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 21 Dec 2006 23:35

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Update comment by auto on 21 Dec 2006 19:37

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Flow stage update by auto on 21 Dec 2006 19:37

Domain "1d5tA01" hits Domain "1gnd001" (100% over 98.2857142857143%) which is currently in process

Flow stage update by auto on 21 Dec 2006 19:37

NW result present for Domain "1d5tA01"

Flow stage update by auto on 19 Dec 2006 15:28

All required files are present for Domain "1d5tA01"

Flow stage update by auto on 18 Dec 2006 15:29

Beginning processing for Domain "1d5tA01"

Insertion by auto on 18 Dec 2006 15:22

Final ChopClose added based on similarity with "1gnd0"