CATH Domain: 1d4tA00 XML data for domain: 1d4tA00

Molscript image for 1d4tA00
1d4tA00
PDB coordinates for domain 1d4tA00

PDB 1d4t, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.2
3.30.505.10.2.1
3.30.505.10.2.1.1
3.30.505.10.2.1.1.1
3.30.505.10.2.1.1.1.1

[top]
Segment boundaries for domain 1d4tA00

Chopping figure for domain 1d4tA00
DomainStart PDB ResidueStop PDB Residue
1d4tA00 1 104

Structural Neighbourhood (24 entries)

There are 24 matching structural neighberhood comparisons for CATH ID 3.30.505.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 24 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1i3zA00 93.36 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 38 98 0.95 0.97
2oq1A01 91.05 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 108 19 91 1.50 1.64
1nrvA00 90.36 CytoplasmInsulin receptor bindingGrowth factor receptor-bound protein 10Plasma membranePositive regulation of phosphorylation 3.30.505.10 100 24 94 1.87 1.98
2oq1A03 89.86 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 99 24 93 1.76 1.89
3eazA00 89.03 Tyrosine-protein kinase CSKEpithelial cell signaling in Helicobacter pylori infectionChemokine signaling pathwayProtein C-terminus bindingNeurotrophin signaling pathway 3.30.505.10 98 28 89 2.13 2.38
1opkA02 88.92 Protein domain specific bindingNucleusManganese ion bindingPeptidyl-tyrosine phosphorylationMus musculus 3.30.505.10 102 29 89 2.14 2.39
3c7iA00 88.50 Jak-STAT signaling pathwayNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathwayErbB signaling pathway 3.30.505.10 101 23 92 2.85 3.09
1ayaA00 88.17 Hormone-mediated signaling pathwayRegulation of multicellular organism growthNerve growth factor receptor signaling pathwayTriglyceride metabolic processNegative regulation of insulin secretion 3.30.505.10 101 26 91 1.75 1.92
2iugA00 87.84 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 24 88 2.19 2.48
1r1pB00 87.81 GRB2-related adaptor protein 2Mus musculusT cell receptor signaling pathwayProtein binding 3.30.505.10 100 19 87 2.29 2.62
1milA00 87.79 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 28 90 2.20 2.43
2shpA02 87.61 Tyrosine-protein phosphatase non-receptor type 11Homo sapiens 3.30.505.10 101 24 88 1.81 2.05
2dm0A01 86.76 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 28 87 2.12 2.42
1qadA00 86.26 Jak-STAT signaling pathwayAldosterone-regulated sodium reabsorptionNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathway 3.30.505.10 104 22 90 2.73 3.02
2crhA01 85.81 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 19 91 2.32 2.54
1ju5A00 85.36 Pathways in cancerChemokine signaling pathwayNeurotrophin signaling pathwayFc gamma R-mediated phagocytosisErbB signaling pathway 3.30.505.10 109 21 83 1.76 2.11
3bkbA01 85.16 Tyrosine-protein kinase Fes/FpsHomo sapiensCell proliferationMulticellular organismal development 3.30.505.10 93 23 83 3.14 3.75
2vifA01 84.61 CytoplasmJAK-STAT cascadeDefense responseSuppressor of cytokine signaling 6Suppressor of cytokine signaling 6 3.30.505.10 126 25 79 2.00 2.52
2kk6A00 84.20 CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer 3.30.505.10 116 25 81 2.46 3.04
2pldA00 83.75 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 23 91 3.35 3.66
3buxB03 82.53 Jak-STAT signaling pathwayPathways in cancerT cell receptor signaling pathwayErbB signaling pathwayChronic myeloid leukemia 3.30.505.10 86 12 74 2.53 3.42
1rpyB00 82.01 SH2B adapter protein 2Nervous system developmentRattus norvegicusInsulin signaling pathwayNeurotrophin signaling pathway 3.30.505.10 85 22 74 3.70 5.00
1uurA04 78.67 Protein homodimerization activityNucleusSignal transducer and activator of transcription APositive regulation of transcriptionCytosol 3.30.505.10 132 13 62 2.89 4.60
1bg1A04 77.07 Positive regulation of transcription from RNA polymerase II promoterTemperature homeostasisRegulation of multicellular organism growthNucleusPlasma membrane 3.30.505.10 109 18 73 3.55 4.84
[1]
Displaying entries 1 to 24 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1d4tA00
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKI
KNLISAFQKPDQGIVIPLQYPVEK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1d4tA00
MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKI
KNLISAFQKPDQGIVIPLQYPVEK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:07

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:30

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"