Set cath from cathlist by auto on 05 Mar 2006 19:29
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1d3yB01 | 72 | 142 |
| 1d3yB02 | 143 | 368 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.1360.10.3.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2zbkA02 | 86.41 | 3.40.1360.10 | 226 | 33 | 92 | 1.49 | 1.62 |
>pdb|1d3yB02 EDGSSVVGPLKIIEETPEGELVVDCTKLGTGAYNIPNDVTKLNLETDADFILAIETSGMFARLNAERFWDKHNCILVSLK GVPARATRRFIKRLHEEHDLPVLVFTDGDPYGYLNIYRTLKVGKLSIPAARLIGVTPQDIIDYDLPTHPLKEQDIKRIKD GLKNDDFVRSFPEWQKALKQMLDMGVRAEQQSLAKYGLKYVVNTYLPEKIKDESTWL
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"