CATH Domain: 1d2zB00 XML data for domain: 1d2zB00

Molscript image for 1d2zB00
1d2zB00
PDB coordinates for domain 1d2zB00

PDB 1d2z, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.533 Death Domain, Fas
1.10.533.10 Death Domain, Fas Gene3D
1.10.533.10.6
1.10.533.10.6.1
1.10.533.10.6.1.1
1.10.533.10.6.1.1.1
1.10.533.10.6.1.1.1.1

[top]
Segment boundaries for domain 1d2zB00

Chopping figure for domain 1d2zB00
DomainStart PDB ResidueStop PDB Residue
1d2zB00 23 172

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.533.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ngrA00 78.05 Negative regulation of muscle organ developmentRattus norvegicusNucleusNeurotrophin signaling pathwayTumor necrosis factor receptor superfamily member 16 1.10.533.10 85 12 56 1.74 3.07
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1d2zB00
LSSKYSRNTELRRVEDNDIYRLAKILDENSCWRKLMSIIPKGMDVQACSGAGCLNFPAEIKKGFKYTAQDVFQIDEAANR
LPPDQSKSQMMIDEWKTSGKLNERPTVGVLLQLLVQAELFSAADFVALDFLNESTPARPVDGPGALISLE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1d2zB00
LSSKYSRNTELRRVEDNDIYRLAKILDENSCWRKLMSIIPKGMDVQACSGAGCLNFPAEIKKGFKYTAQDVFQIDEAANR
LPPDQSKSQMMIDEWKTSGKLNERPTVGVLLQLLVQAELFSAADFVALDFLNESTPARPVDGPGALISLELLE
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:33

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"