CATH Domain: 1d2zA00 XML data for domain: 1d2zA00

Molscript image for 1d2zA00
1d2zA00
PDB coordinates for domain 1d2zA00

PDB 1d2z, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.533 Death Domain, Fas
1.10.533.10 Death Domain, Fas Gene3D
1.10.533.10.2
1.10.533.10.2.1
1.10.533.10.2.1.1
1.10.533.10.2.1.1.1
1.10.533.10.2.1.1.1.1

[top]
Segment boundaries for domain 1d2zA00

Chopping figure for domain 1d2zA00
DomainStart PDB ResidueStop PDB Residue
1d2zA00 28 129

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.10.533.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ngrA00 82.60 Negative regulation of muscle organ developmentRattus norvegicusNucleusNeurotrophin signaling pathwayTumor necrosis factor receptor superfamily member 16 1.10.533.10 85 20 83 2.36 2.83
1wmgA00 81.71 Mus musculusNetrin receptor UNC5BNetrin receptor unc-5Axon guidance 1.10.533.10 86 16 78 3.27 4.17
1a1wA00 81.53 FAS (TNFRSF6)-associated via death domainIdentical protein bindingPathways in cancerChagas diseaseAlzheimer's disease 1.10.533.10 83 13 76 2.67 3.49
1d2zB00 80.38 Protein domain specific bindingHemocyte proliferationPlasma membraneDrosophila melanogasterToll signaling pathway 1.10.533.10 150 20 66 2.49 3.77
3ygsP00 79.98 Pathways in cancerActivation of caspase activity by cytochrome cEnzyme activator activityNon-small cell lung cancerAlzheimer's disease 1.10.533.10 97 11 86 4.17 4.83
1ichA00 79.62 Integral to plasma membraneChagas diseaseTumor necrosis factor receptor superfamily member 1AAlzheimer's diseasePositive regulation of I-kappaB kinase/NF-kappaB cascade 1.10.533.10 87 12 81 3.11 3.82
1dgnA00 78.70 Caspase recruitment domain-containing protein 18NOD-like receptor signaling pathwayCaspase recruitment domain-containing protein 18Homo sapiens 1.10.533.10 89 5 83 3.18 3.82
1ucpA00 78.07 Protein homodimerization activityApoptosis-associated speck-like protein containing a CARDPositive regulation of interleukin-1 beta secretionPyrin domain bindingTumor necrosis factor-mediated signaling pathway 1.10.533.10 91 4 80 3.61 4.49
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1d2zA00
LDNTMAIRLLPLPVRAQLCAHLDALDVWQQLATAVKLYPDQVEQISSQKQRGRSASNEFLNIWGGQYNHTVQTLFALFKK
LKLHNAMRLIKDYVSEDLHKYI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1d2zA00
GSHMSHLDNTMAIRLLPLPVRAQLCAHLDALDVWQQLATAVKLYPDQVEQISSQKQRGRSASNEFLNIWGGQYNHTVQTL
FALFKKLKLHNAMRLIKDYVSEDLHKYI
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:13

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:33

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"