CATH Domain: 1cz3B00 XML data for domain: 1cz3B00

Molscript image for 1cz3B00
1cz3B00
PDB coordinates for domain 1cz3B00

PDB 1cz3, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.430 Dihydrofolate Reductase, subunit A
3.40.430.10 Dihydrofolate Reductase, subunit A Gene3D
3.40.430.10.11
3.40.430.10.11.1
3.40.430.10.11.1.1
3.40.430.10.11.1.1.1
3.40.430.10.11.1.1.1.1

[top]
Segment boundaries for domain 1cz3B00

Chopping figure for domain 1cz3B00
DomainStart PDB ResidueStop PDB Residue
1cz3B00 1 168

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.40.430.10.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qzfA01 87.15 Pyrimidine metabolismThymidylate synthase [EC:2.1.1.45]One carbon pool by folateBifunctional dihydrofolate reductase-thymidylate synthaseFolate biosynthesis 3.40.430.10 176 25 90 2.43 2.67
1vdrA00 85.83 One carbon pool by folateDihydrofolate reductaseHaloferax volcaniiFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 157 19 92 2.54 2.75
2bl9A00 82.58 Bifunctional dihydrofolate reductase-thymidylate synthasePlasmodium vivax 3.40.430.10 216 22 74 2.56 3.46
2p4gA00 80.63 Corynebacterium diphtheriaePutative uncharacterized protein 3.40.430.10 244 17 67 2.64 3.93
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1cz3B00
AKVIFVLAMDVSGKIASSVESWSSFEDRKNFRKITTEIGNVVMGRITFEEIGRPLPERLNVVLTRRPKTSNNPSLVFFNG
SPADVVKFLEGKGYERVAVIGGKTVFTEFLREKLVDELFVTVEPYVFGKGIPFFDEFEGYFPLKLLEMRRLNERGTLFLK
YSVEKSHR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1cz3B00
AKVIFVLAMDVSGKIASSVESWSSFEDRKNFRKITTEIGNVVMGRITFEEIGRPLPERLNVVLTRRPKTSNNPSLVFFNG
SPADVVKFLEGKGYERVAVIGGKTVFTEFLREKLVDELFVTVEPYVFGKGIPFFDEFEGYFPLKLLEMRRLNERGTLFLK
YSVEKSHR
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:26

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:48

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"