Set cath from cathlist by auto on 05 Mar 2006 18:51
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
There are 2 matching structural neighberhood comparisons for CATH ID 3.10.120.10.4.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1x3xA00 | 91.78 | 3.10.120.10 | 82 | 27 | 97 | 2.00 | 2.05 | |
![]() |
3ks0A00 | 86.40 | 3.10.120.10 | 92 | 32 | 82 | 1.98 | 2.40 |
>pdb|1cxyA00 TLPVFTLEQVAEHHSPDDCWMAIHGKVYDLTPYVPNHPGPAGMMLVWCGQESTEAWETKSYGEPHSSLAARLLQRYLIGT L
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"