Set cath from cathlist by auto on 05 Mar 2006 18:29
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1cqxA01 | 1 | 150 |
| 1cqxA02 | 151 | 261 |
| 1cqxA03 | 262 | 403 |
There are 16 matching structural neighberhood comparisons for CATH ID 2.40.30.10.1.1.1.1.1 (SIMAX score < 5)
>pdb|1cqxA02 WKGWRTFVIREKRPESDVITSFILEPADGGPVVNFEPGQYTSVAIDVPALGLQQIRQYSLSDMPNGRTYRISVKREGGGP QPPGYVSNLLHDHVNVGDQVKLAAPYGSFHI
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"