CATH Domain: 1cnt300 XML data for domain: 1cnt300

Molscript image for 1cnt300
1cnt300
PDB coordinates for domain 1cnt300

PDB 1cnt, Chain 3, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1250 Growth Hormone; Chain: A;
1.20.1250.10 Gene3D
1.20.1250.10.13
1.20.1250.10.13.1
1.20.1250.10.13.1.1
1.20.1250.10.13.1.1.1
1.20.1250.10.13.1.1.1.2

[top]
Segment boundaries for domain 1cnt300

Chopping figure for domain 1cnt300
DomainStart PDB ResidueStop PDB Residue
1cnt300 11 182

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.20.1250.10.13.1.1.1.2 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1i1rB00 82.97 Interleukin-6 homologHuman herpesvirus 8 1.20.1250.10 167 12 72 2.57 3.55
1lkiA00 82.88 Negative regulation of ERK1 and ERK2 cascadeCytokine activityLung vasculature developmentBlood vessel remodelingLung lobe morphogenesis 1.20.1250.10 172 12 69 2.69 3.89
2jdiH02 68.71 F-type H+-transporting ATPase subunit delta [EC:3.6.3.14]Huntington's diseaseOxidative phosphorylationParkinson's diseaseBos taurus 1.20.5.440 42 4 32 1.56 4.83
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1cnt300
PHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAI
HTLLLQVAAFAYQIEELMILLEYKIPRNEADGGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1cnt300
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAY
RTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLK
VLQELSQWTVRSIHDLRFISSHQTGIP
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:42

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"