CATH Domain: 1ckmA03 XML data for domain: 1ckmA03

Molscript image for 1ckmA03
1ckmA03
PDB coordinates for domain 1ckmA03

PDB 1ckm, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.87 mRNA Capping Enzyme; Chain
4.10.87.10 mRNA Capping Enzyme; domain 3 Gene3D
4.10.87.10.1
4.10.87.10.1.1
4.10.87.10.1.1.1
4.10.87.10.1.1.1.1
4.10.87.10.1.1.1.1.1

[top]
Segment boundaries for domain 1ckmA03

Chopping figure for domain 1ckmA03
DomainStart PDB ResidueStop PDB Residue
1ckmA01 11 59
1ckmA01 84 189
1ckmA02 236 318
1ckmA03 190 235
1ckmA03 319 326

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 4.10.87.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ethA03 75.84 Purine metabolismMetabolic pathways5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]Phosphoribosylaminoimidazole carboxylase ATPase subunitEscherichia coli K-12 3.30.1490.20 62 11 74 3.28 4.42
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ckmA03
WIPLEHPTIIKDHLKKANAIYHTDGLIIMSVDEPVIYGRNFNLFKLTIDELLDL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ckmA03
WIPLEHPTIIKDHLKKANAIYHTDGLIIMSVDEPVIYGRNFNLFKLTIDELLDL
BLAST against CATH

[top]
Domain History Events (2)

Insertion by lewis on 18 Jan 2007 19:01

Rechopping chains just before release v3.1.0 in order to fix missing fragments.

Domain assigned by lewis on 18 Jan 2007 19:01

Reassigning this domain to its previous classification as part of fragment fixing process in preparation for release v3.1.0.