Classification merge by cuff on 16 Jun 2009 15:42
COMMENT: merge 3.90.63.10 -> 3.30.470.30 FINAL: merge superfamilies - evidence from scop
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ckmA01 | 11 | 59 |
| 1ckmA01 | 84 | 189 |
| 1ckmA02 | 236 | 318 |
| 1ckmA03 | 190 | 235 |
| 1ckmA03 | 319 | 326 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.470.30.6.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1x9nA03 | 77.67 | 3.30.470.30 | 126 | 12 | 60 | 2.86 | 4.72 |
>pdb|1ckmA01 NITTERAVLTLNGLQIKLHKVVGESRDDIVAKMKDLAMDDHKFPRLPGPDGIRFMMFFTRVFGFKVCTIIDRAMTVYLLP FKNIPRVLFQGSIFDGELCVDIVEKKFAFVLFDAVVVSGVTVSQMDLASRFFAMKRSLKEFKNVPEDPAILRYKE
COMMENT: merge 3.90.63.10 -> 3.30.470.30 FINAL: merge superfamilies - evidence from scop
Rechopping chains just before release v3.1.0 in order to fix missing fragments.
Reassigning this domain to its previous classification as part of fragment fixing process in preparation for release v3.1.0.