CATH Domain: 1cjwA00

There are 26 matching structural neighberhood comparisons for CATH ID 3.40.630.30.20.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	2i79D00	84.57	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	167	18	88	2.85	3.22
	3efaA00	84.14	Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation	3.40.630.30	141	9	82	2.42	2.93
	2ge3B00	84.10	Agrobacterium tumefaciens str. C58Probable acetyltransferase	3.40.630.30	159	13	87	2.88	3.30
	3k9uA00	84.08	Putative uncharacterized protein Ta0374Thermoplasma acidophilum	3.40.630.30	159	16	84	2.66	3.15
	2fiaA00	83.71	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	157	10	86	2.41	2.80
	1n71B00	83.19	Aac(6')-Ii proteinEnterococcus faecium	3.40.630.30	179	14	79	2.64	3.33
	2i00C01	83.17	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	12	77	3.50	4.50
	2q7bA00	83.10	Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V	3.40.630.30	161	13	85	2.71	3.17
	3g8wA00	82.87	Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05	3.40.630.30	158	15	87	3.18	3.64
	1xebA00	82.82	Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein	3.40.630.30	146	13	84	2.74	3.23
	3d8pB00	82.55	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	157	13	83	2.65	3.16
	1q2yA00	82.52	Bacillus subtilisUncharacterized N-acetyltransferase yjcF	3.40.630.30	140	14	83	3.16	3.77
	2ae6A00	81.91	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	14	82	3.84	4.65
	2pdoA01	81.66	Shigella flexneriAcetyltransferase ypeA	3.40.630.30	118	22	69	2.28	3.26
	2ozgA01	81.27	Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase	3.40.630.30	117	15	69	2.83	4.05
	1y9wA01	80.32	AcetyltransferaseBacillus cereus ATCC 14579	3.40.630.30	104	21	61	2.73	4.44
	2atrA00	79.81	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	127	16	72	3.25	4.46
	1y7rA00	79.06	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	125	12	73	3.11	4.23
	2fl4A02	78.87	Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis	3.40.630.30	104	16	60	2.51	4.17
	3ey5A01	78.79	Acetyltransferase-like, GNAT familyBacteroides thetaiotaomicron	3.40.630.30	144	16	71	3.53	4.97
	1lrzA01	78.76	Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus	3.40.630.30	143	9	77	3.78	4.90
	1yreC00	78.25	Pseudomonas aeruginosaPutative uncharacterized protein	3.40.630.30	182	9	84	4.13	4.91
	2ozhA01	77.97	Xanthomonas campestris pv. campestrisPutative uncharacterized protein	3.40.630.30	120	20	68	3.36	4.89
	1nslA00	77.24	Bacillus subtilisPutative ribosomal N-acetyltransferase ydaF	3.40.630.30	173	9	86	4.30	4.99
	2r1iA01	77.03	Arthrobacter sp. FB24GCN5-related N-acetyltransferase	3.40.630.30	129	18	69	3.43	4.95
	2hqyA01	73.84	Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein	3.40.630.30	130	7	74	3.70	4.99

>pdb|1cjwA00
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESL
ALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFT
EMHCSL    

>pdb|1cjwA00
HTLPANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESL
ALHRPRGHSAHLHALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVPFYQRFGFHPAGPCAIVVGSLTFT
EMHCSL