Set cath from cathlist by auto on 05 Mar 2006 18:16
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1cjaA01 | 2 | 166 |
| 1cjaA02 | 167 | 343 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1cjaA02 GITLNKLTTTSAPEVLTKSTMQQLGSLMALDVIVNNSDRLPIAWTNEGNLDNIMLSERGATVVPIDSKIIPLDASHPHGE RVRELLRTLIAHPGHESSQFHSIRDIITLYTGYDVGTEGSISMQEGFLATVRECASFDLDAFERELLSWQESLQKCHNLS ISPQAIPFILRMLRIFH
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"