Set cath from cathlist by auto on 05 Mar 2006 19:13
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1cipA01 | 32 | 61 |
| 1cipA01 | 181 | 347 |
| 1cipA02 | 62 | 180 |
There are 20 matching structural neighberhood comparisons for CATH ID 3.40.50.300.19.1.1.1.1 (SIMAX score < 5)
>pdb|1cipA01 REVKLLLLGAGESGKSTIVKQMKIIHEAGYTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDY DLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDL NKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNN
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"