CATH Domain: 1chuA02 XML data for domain: 1chuA02

Molscript image for 1chuA02
1chuA02
PDB coordinates for domain 1chuA02

PDB 1chu, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.700 Flavocytochrome C3; Chain A, domain 1
3.90.700.10 Flavocytochrome C3; Chain A, domain 1 Gene3D
3.90.700.10.4
3.90.700.10.4.1
3.90.700.10.4.1.1
3.90.700.10.4.1.1.1
3.90.700.10.4.1.1.1.1

[top]
Segment boundaries for domain 1chuA02

Chopping figure for domain 1chuA02
DomainStart PDB ResidueStop PDB Residue
1chuA01 2 239
1chuA01 355 410
1chuA02 245 348
1chuA03 429 516

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1chuA02
PTALYHPQARNFLLTEALRGEGAYLKRPDGTRFMPDFDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQH
FPMIYEKLLGLGIDLTQEPVPIVP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1chuA02
PTALYHPQARNFLLTEALRGEGAYLKRPDGTRFMPDFDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQH
FPMIYEKLLGLGIDLTQEPVPIVP
BLAST against CATH

[top]
Domain History Events (7)

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1chuA02 to 3.90.700.10 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1chuA02 (from the previous chopping at "Sun Mar 5 16:16:49 2006") which was in 3.90.700.10 at the time the chain was unchopped.

Flow stage update by auto on 21 Dec 2006 19:39

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Dec 2006 19:37

No in_process hits for Domain "1chuA02" ready to be processed

Flow stage update by auto on 21 Dec 2006 19:37

NW result present for Domain "1chuA02"

Flow stage update by auto on 20 Dec 2006 19:31

All required files are present for Domain "1chuA02"

Flow stage update by auto on 19 Dec 2006 19:40

Beginning processing for Domain "1chuA02"

Insertion by cuff on 19 Dec 2006 17:31

small batch of choppings to go