CATH Domain: 1chcA00 XML data for domain: 1chcA00

Molscript image for 1chcA00
1chcA00
PDB coordinates for domain 1chcA00

PDB 1chc, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.40 Herpes Virus-1
3.30.40.10 Zinc/RING finger domain, C3HC4 (zinc finger) Gene3D
3.30.40.10.12
3.30.40.10.12.1
3.30.40.10.12.1.1
3.30.40.10.12.1.1.1
3.30.40.10.12.1.1.1.1

[top]
Segment boundaries for domain 1chcA00

Chopping figure for domain 1chcA00
DomainStart PDB ResidueStop PDB Residue
1chcA00 1 68

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.40.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1iymA00 80.58 Oryza sativa Japonica GroupE3 ubiquitin-protein ligase EL5 3.30.40.10 55 25 76 3.75 4.90
1g25A00 77.41 CDK-activating kinase assembly factor MAT1Positive regulation of transcription from RNA polymerase II promoterZinc ion bindingProtein N-terminus bindingNucleotide excision repair 3.30.40.10 65 20 85 3.84 4.50
1vyxA00 75.40 Human herpesvirus 8E3 ubiquitin-protein ligase MIR1 3.30.40.10 60 15 80 3.90 4.82
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1chcA00
MATVAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDSEFGDQLI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1chcA00
MATVAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVHTIESDSEFGDQLI
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1chc000" to "1chcA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:58

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:58

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:25

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"