CATH Domain: 1cdwA01 XML data for domain: 1cdwA01

Molscript image for 1cdwA01
1cdwA01
PDB coordinates for domain 1cdwA01

PDB 1cdw, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.310 TATA-Binding Protein
3.30.310.10 TATA-Binding Protein Gene3D
3.30.310.10.1
3.30.310.10.1.1
3.30.310.10.1.1.4
3.30.310.10.1.1.4.1
3.30.310.10.1.1.4.1.1

[top]
Segment boundaries for domain 1cdwA01

Chopping figure for domain 1cdwA01
DomainStart PDB ResidueStop PDB Residue
1cdwA01 155 165
1cdwA01 252 333
1cdwA02 166 251

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.310.10.1.1.4.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qnaA02 90.05 Arabidopsis thalianaProtein bindingTATA-box-binding protein 1 3.30.310.10 86 25 82 1.56 1.88
2z8uB02 88.42 Methanocaldococcus jannaschiiTATA-box-binding proteinTranscription initiation factor TFIID TATA-box-binding proteinBasal transcription factors 3.30.310.10 87 36 82 1.87 2.26
1p5dX04 79.85 Galactose metabolismAmino sugar and nucleotide sugar metabolismFructose and mannose metabolismMetabolic pathwaysStarch and sucrose metabolism 3.30.310.50 93 10 75 3.35 4.45
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1cdwA01
SGIVPQLQNIVQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEA
FENIYPILKGFRK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1cdwA01
SGIVPQLQNIVQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEA
FENIYPILKGFRK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:16

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"