CATH Domain: 1c96A02 XML data for domain: 1c96A02

Molscript image for 1c96A02
1c96A02
PDB coordinates for domain 1c96A02

PDB 1c96, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1060 Aconitase; Domain 2
3.40.1060.10 Aconitase, Domain 2 Gene3D
3.40.1060.10.1
3.40.1060.10.1.1
3.40.1060.10.1.1.1
3.40.1060.10.1.1.1.1
3.40.1060.10.1.1.1.1.1

[top]
Segment boundaries for domain 1c96A02

Chopping figure for domain 1c96A02
DomainStart PDB ResidueStop PDB Residue
1c96A01 2 202
1c96A02 203 315
1c96A03 316 490
1c96A04 534 754

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.1060.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1l5jA03 78.43 Citrate cycle (TCA cycle)Metabolic pathwaysGlyoxylate and dicarboxylate metabolismRegulation of translationAconitate hydratase 2 [EC:4.2.1.3] 3.40.1060.10 173 17 61 2.55 4.12
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1c96A02
IGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSK
TGRADIANLADEFKDHLVPDPGCHYDQVIEINL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1c96A02
IGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSK
TGRADIANLADEFKDHLVPDPGCHYDQVIEINL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:15

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"