Set cath from cathlist by auto on 05 Mar 2006 19:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1c7sA01 | 28 | 169 |
| 1c7sA02 | 209 | 335 |
| 1c7sA03 | 336 | 819 |
| 1c7sA04 | 820 | 885 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.379.10.3.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1jakA02 | 82.71 | 3.30.379.10 | 141 | 16 | 85 | 3.27 | 3.84 |
>pdb|1c7sA02 PAGALRGKIVPTPMQVKVHAQDADLRKGVALDLSTLVKPAADVVSQRFALLGVPVQTNGYPIKTDIQPGKFKGAMAVSGA YELKIGKKEAQVIGFDQAGVFYGLQSILSLVPSDGSGKIATLDASDA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"