CATH Domain: 1c7sA02 XML data for domain: 1c7sA02

Molscript image for 1c7sA02
1c7sA02
PDB coordinates for domain 1c7sA02

PDB 1c7s, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.379 Chitobiase; domain 2
3.30.379.10 Chitobiase, domain 2 Gene3D
3.30.379.10.3
3.30.379.10.3.1
3.30.379.10.3.1.1
3.30.379.10.3.1.1.1
3.30.379.10.3.1.1.1.1

[top]
Segment boundaries for domain 1c7sA02

Chopping figure for domain 1c7sA02
DomainStart PDB ResidueStop PDB Residue
1c7sA01 28 169
1c7sA02 209 335
1c7sA03 336 819
1c7sA04 820 885

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.379.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jakA02 82.71 B-N-acetylhexosaminidaseStreptomyces plicatus 3.30.379.10 141 16 85 3.27 3.84
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1c7sA02
PAGALRGKIVPTPMQVKVHAQDADLRKGVALDLSTLVKPAADVVSQRFALLGVPVQTNGYPIKTDIQPGKFKGAMAVSGA
YELKIGKKEAQVIGFDQAGVFYGLQSILSLVPSDGSGKIATLDASDA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1c7sA02
PAGALRGKIVPTPMQVKVHAQDADLRKGVALDLSTLVKPAADVVSQRFALLGVPVQTNGYPIKTDIQPGKFKGAMAVSGA
YELKIGKKEAQVIGFDQAGVFYGLQSILSLVPSDGSGKIATLDASDA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:04

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:15

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"