CATH Domain: 1c3gA01 XML data for domain: 1c3gA01

Molscript image for 1c3gA01
1c3gA01
PDB coordinates for domain 1c3gA01

PDB 1c3g, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.260 HSP40/DNAj peptide-binding domain
2.60.260.20 Urease metallochaperone UreE, N-terminal domain Gene3D
2.60.260.20.4
2.60.260.20.4.1
2.60.260.20.4.1.1
2.60.260.20.4.1.1.1
2.60.260.20.4.1.1.1.1

[top]
Segment boundaries for domain 1c3gA01

Chopping figure for domain 1c3gA01
DomainStart PDB ResidueStop PDB Residue
1c3gA01 180 257
1c3gA02 258 338

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.60.260.20.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nltA01 89.07 Identical protein binding'de novo' protein foldingMicrosomeDnaJ homolog subfamily A member 2Protein targeting to mitochondrion 2.60.260.20 80 19 95 1.78 1.87
1c3gA02 84.19 Identical protein bindingProtein SIS1Saccharomyces cerevisiaeTranslational initiationCytosolic small ribosomal subunit 2.60.260.20 81 15 86 1.86 2.15
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1c3gA01
ETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1c3gA01
ETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKS
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 26 Apr 2006 13:32

COMMENT: Ali - both chapones .. SCOP suggests they belong to same superfamily. superposition OK and suggests very similar topology. I would suggest merging at the H level FINAL: Lesley - Fine. Merge based on SCOP. e-values are marginal. Move 10 to 20.

Flow stage update by cuff on 26 Apr 2006 13:32

COMMENT: Ali - both chapones .. SCOP suggests they belong to same superfamily. superposition OK and suggests very similar topology. I would suggest merging at the H level FINAL: Lesley - Fine. Merge based on SCOP. e-values are marginal. Move 10 to 20.

Set cath from cathlist by auto on 05 Mar 2006 18:47

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:47

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:14

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"