Set cath from cathlist by auto on 05 Mar 2006 18:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1c3cA01 | 2 | 92 |
| 1c3cA02 | 93 | 348 |
| 1c3cA03 | 349 | 429 |
There are 7 matching structural neighberhood comparisons for CATH ID 1.10.40.30.4.1.1.1.1 (SIMAX score < 5)
>pdb|1c3cA03 KGLVFSQRVLLKLIEKGLTRKEAYDIVQRNALKTWNSEKHFLEYLLEDEEVKKLVTKEELEELFDISYYLKHVDHIFERF E
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"