Set cath from cathlist by auto on 05 Mar 2006 19:16
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1c1dA01 | 3 | 64 |
| 1c1dA01 | 75 | 136 |
| 1c1dA01 | 339 | 349 |
| 1c1dA02 | 137 | 338 |
There are 13 matching structural neighberhood comparisons for CATH ID 3.40.50.720.3.1.1.1.1 (SIMAX score < 5)
>pdb|1c1dA02 FGRSLERGGAGSSAFTTAVGVFEAMKATVAHRGLGSLDGLTVLVQGLGAVGGSLASLAAEAGAQLLVADTDTERVAHAVA LGHTAVALEDVLSTPCDVFAPCAMGGVITTEVARTLDCSVVAGAANNVIADEAASDILHARGILYAPDFVANAGGAIHLV GREVLGWSESVVHERAVAIGDTLNQVFEISDNDGVTPDEAAR
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"