Set cath from cathlist by auto on 05 Mar 2006 19:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1c1dA01 | 3 | 64 |
| 1c1dA01 | 75 | 136 |
| 1c1dA01 | 339 | 349 |
| 1c1dA02 | 137 | 338 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.192.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1lehA01 | 90.05 | 3.40.192.10 | 151 | 32 | 86 | 1.57 | 1.82 |
>pdb|1c1dA01 DSALNWDGEMTVTRFDAMTGAHFVIRLDSTQLGPAAGGTRAAQYSNLADALTDAGKLAGAMTGGGKSVIALPAPRHSIDP STWARILRIHAENIDKLSGNYWTGPDVNTNSADMDTLNDTTEFVTLAGRRAREAS
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"