CATH Domain: 1c0wB03 XML data for domain: 1c0wB03

Molscript image for 1c0wB03
1c0wB03
PDB coordinates for domain 1c0wB03

PDB 1c0w, Chain B, Domain 3

This domain is in the HOLDING_PEN flow stage and therefore has not yet been assigned to a homologous superfamily in CATH. You can view the domain history to see more information.

[top]
Segment boundaries for domain 1c0wB03

Chopping figure for domain 1c0wB03
DomainStart PDB ResidueStop PDB Residue
1c0wB01 2 73
1c0wB02 74 140
1c0wB03 147 226

Structural Neighbourhood ( entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1c0wB03
APGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1c0wB03
APGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL
BLAST against CATH

[top]
Domain History Events (12)

Update comment by auto on 14 Oct 2010 11:36

Domain "1c0wB03" hits Domain "1c0wA03" (100% over 77.5%) which is currently in process

Update comment by auto on 13 Oct 2010 17:48

Domain "1c0wB03" hits Domain "1c0wA03" (100% over 77.5%) which is currently in process

Update comment by auto on 04 Aug 2010 02:02

Domain "1c0wB03" hits Domain "1c0wA03" (100% over 77.5%) which is currently in process

Update comment by auto on 23 Jul 2008 18:02

Domain "1c0wB03" hits Domain "1c0wA03" (100% over 77.5%) which is currently in process

Update comment by auto on 03 Sep 2007 20:10

Domain "1c0wB03" hits Domain "1c0wA03" (100% over 77.5%) which is currently in process

Update comment by auto on 03 Sep 2007 11:17

Domain "1c0wB03" hits Domain "1c0wA03" (100% over 77.5%) which is currently in process

Update comment by auto on 22 Aug 2007 15:20

Domain "1c0wB03" hits Domain "1c0wA03" (100% over 77.5%) which is currently in process

Flow stage update by auto on 22 Aug 2007 15:19

Domain "1c0wB03" hits Domain "1c0wA03" (100% over 77.5%) which is currently in process

Flow stage update by auto on 22 Aug 2007 15:19

NW result present for Domain "1c0wB03"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "1c0wB03"

Flow stage update by auto on 18 Aug 2007 20:23

Beginning processing for Domain "1c0wB03"

Insertion by auto on 18 Aug 2007 18:29

Final ChopClose added based on similarity with "1fx7A"