CATH Domain: 1c0wB02 XML data for domain: 1c0wB02

Molscript image for 1c0wB02
1c0wB02
PDB coordinates for domain 1c0wB02

PDB 1c0w, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.60 Diphtheria Toxin Repressor; domain 2
1.10.60.10 Diphtheria Toxin Repressor, domain 2 Gene3D
1.10.60.10.2
1.10.60.10.2.1
1.10.60.10.2.1.1
1.10.60.10.2.1.1.1
1.10.60.10.2.1.1.1.9

[top]
Segment boundaries for domain 1c0wB02

Chopping figure for domain 1c0wB02
DomainStart PDB ResidueStop PDB Residue
1c0wB01 2 73
1c0wB02 74 140
1c0wB03 147 226

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.60.10.2.1.1.1.9 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1f5tA02 89.82 DtxR family transcriptional regulator, Mn-dependent transcriptional regulatorDiphtheria toxin repressorCorynebacterium diphtheriae 1.10.60.10 46 97 69 0.41 0.59
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1c0wB02
AVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1c0wB02
AVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGV
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 22 Aug 2007 18:32

Assigning to "1.10.60.10" based on similarity with "2dtr002"

Flow stage update by auto on 22 Aug 2007 18:31

No in_process hits for Domain "1c0wB02" ready to be processed

Update comment by auto on 22 Aug 2007 18:24

Domain "1c0wB02" hits Domain "1c0wD02" (100% over 98.5074626865672%) which is currently in process

Update comment by auto on 22 Aug 2007 15:20

Domain "1c0wB02" hits Domain "1c0wA02" (100% over 98.5074626865672%) which is currently in process

Flow stage update by auto on 22 Aug 2007 15:19

Domain "1c0wB02" hits Domain "1c0wA02" (100% over 98.5074626865672%) which is currently in process

Flow stage update by auto on 22 Aug 2007 15:19

NW result present for Domain "1c0wB02"

Flow stage update by auto on 19 Aug 2007 10:12

All required files are present for Domain "1c0wB02"

Flow stage update by auto on 18 Aug 2007 20:23

Beginning processing for Domain "1c0wB02"

Insertion by auto on 18 Aug 2007 18:29

Final ChopClose added based on similarity with "1fx7A"