CATH Domain: 1bxrA07 XML data for domain: 1bxrA07

Molscript image for 1bxrA07
1bxrA07
PDB coordinates for domain 1bxrA07

PDB 1bxr, Chain A, Domain 7

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.7
3.30.1490.20.7.1
3.30.1490.20.7.1.1
3.30.1490.20.7.1.1.1
3.30.1490.20.7.1.1.1.1

[top]
Segment boundaries for domain 1bxrA07

Chopping figure for domain 1bxrA07
DomainStart PDB ResidueStop PDB Residue
1bxrA01 1 116
1bxrA02 117 140
1bxrA02 211 403
1bxrA03 141 210
1bxrA04 404 523
1bxrA05 524 663
1bxrA06 664 686
1bxrA06 757 936
1bxrA07 687 756
1bxrA08 937 1042

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1w96A03 88.87 Endoplasmic reticulum membraneAcetyl-CoA carboxylaseProtein import into nucleusBiotin carboxylase [EC:6.3.4.14]Nuclear envelope organization 3.30.1490.20 63 25 90 1.56 1.73
1ehiA03 88.22 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.1490.20 68 10 91 1.76 1.93
1gsaA03 86.95 Glutathione metabolismMetabolic pathwaysGlutathione synthase [EC:6.3.2.3]Protein bindingCytosol 3.30.1490.20 65 10 91 2.72 2.98
1vkzA02 86.91 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.30.1490.20 70 18 94 2.51 2.66
1i7nA01 84.96 Rattus norvegicusRegulation of neurotransmitter secretionSynapsin-2Cytoskeletal protein binding 3.30.1490.20 60 11 85 2.41 2.81
2nu8B02 84.45 Citrate cycle (TCA cycle)Propanoate metabolismMetabolic pathwaysC5-Branched dibasic acid metabolismTricarboxylic acid cycle 3.30.1490.20 84 18 78 2.06 2.62
2r6fA03 77.62 Nucleotide excision repairGeobacillus kaustophilusExcinuclease ABC subunit AExcinuclease ABC subunit A 3.30.1490.20 70 11 75 3.10 4.09
1ta8A02 77.07 DNA ligase (NAD+) [EC:6.5.1.2]DNA replicationNucleotide excision repairBase excision repairDNA ligase 3.30.1490.70 99 2 65 3.21 4.89
3l4jA02 76.17 Reciprocal meiotic recombinationDNA topoisomerase 2Regulation of mitotic recombinationDNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 3.30.1490.30 47 6 60 2.95 4.92
1fviA01 75.79 Paramecium bursaria Chlorella virus 1A544R protein 3.30.1490.70 79 12 72 3.56 4.93
2pn1A02 73.88 Pyrimidine metabolismExiguobacterium sibiricum 255-15Alanine, aspartate and glutamate metabolismCarbamoyl-phosphate synthase large subunit [EC:6.3.5.5]Metabolic pathways 3.30.1490.20 61 8 54 2.65 4.88
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bxrA07
LKQPANATVTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLDHFL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bxrA07
LKQPANATVTAIEMAVEKAKEIGYPLVVRPSYVLGGRAMEIVYDEADLRRYFQTAVSVSNDAPVLLDHFL
BLAST against CATH

[top]
Domain History Events (5)

Flow stage update by auto on 21 Dec 2006 19:37

No in_process hits for Domain "1bxrA07" ready to be processed

Flow stage update by auto on 21 Dec 2006 19:37

NW result present for Domain "1bxrA07"

Flow stage update by auto on 21 Dec 2006 15:34

All required files are present for Domain "1bxrA07"

Flow stage update by auto on 21 Dec 2006 15:34

Beginning processing for Domain "1bxrA07"

Insertion by cuff on 21 Dec 2006 11:59

nice selection of choppings