CATH Domain: 1bxrA05 XML data for domain: 1bxrA05

Molscript image for 1bxrA05
1bxrA05
PDB coordinates for domain 1bxrA05

PDB 1bxr, Chain A, Domain 5

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.20 Gene3D
3.40.50.20.17
3.40.50.20.17.1
3.40.50.20.17.1.1
3.40.50.20.17.1.1.1
3.40.50.20.17.1.1.1.1

[top]
Segment boundaries for domain 1bxrA05

Chopping figure for domain 1bxrA05
DomainStart PDB ResidueStop PDB Residue
1bxrA01 1 116
1bxrA02 117 140
1bxrA02 211 403
1bxrA03 141 210
1bxrA04 404 523
1bxrA05 524 663
1bxrA06 664 686
1bxrA06 757 936
1bxrA07 687 756
1bxrA08 937 1042

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 3.40.50.20.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1lssA00 76.54 Trk system potassium uptake protein TrkATrk system potassium uptake protein trkA homologMethanocaldococcus jannaschii 3.40.50.720 132 10 65 2.57 3.91
1m1nB03 75.96 Nitrogenase molybdenum-iron protein beta chain [EC:1.18.6.1]Nitrogen metabolismAzotobacter vinelandiiNitrogenase molybdenum-iron protein beta chainMetabolic pathways 3.40.50.1980 106 13 61 2.46 4.00
1kaeA01 75.93 Histidine metabolismMetabolic pathwaysHistidinol dehydrogenaseHistidine biosynthetic processHistidinol dehydrogenase [EC:1.1.1.23] 3.40.50.1980 155 9 70 3.28 4.62
2hmtA00 75.71 Trk system potassium uptake protein TrkABacillus subtilisKtr system potassium uptake protein A 3.40.50.720 139 14 66 2.65 3.99
2aefA01 75.66 Methanothermobacter thermautotrophicus str. Delta HCalcium-gated potassium channel mthK 3.40.50.720 115 11 64 2.80 4.36
1e5dA01 75.38 Desulfovibrio gigasRubredoxin-oxygen oxidoreductase 3.40.50.360 143 5 54 2.66 4.88
3eq2B01 75.34 Pseudomonas aeruginosaProbable two-component response regulator 3.40.50.2300 103 9 50 2.31 4.62
1id1A00 75.14 Voltage-gated potassium channel activityVoltage-gated potassium channelPotassium ion transportPutative potassium channel proteinEscherichia coli K-12 3.40.50.720 153 7 61 2.68 4.36
3eagA01 74.49 UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC:6.3.2.-]Neisseria meningitidis serogroup BUDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase 3.40.50.720 88 13 61 2.93 4.77
2qsjB00 74.30 DNA-binding response regulator, LuxR familyRuegeria pomeroyi 3.40.50.2300 122 5 50 2.45 4.90
2jk1A00 74.28 Hydrogenase transcriptional regulatory protein hupR1Rhodobacter capsulatus 3.40.50.2300 138 7 50 2.45 4.90
2qr3A00 74.07 Bacteroides fragilisTwo-component system response regulator 3.40.50.2300 119 9 51 2.45 4.76
1ny5A01 74.04 Transcriptional regulator (NtrC family)Two-component system, NtrC family, response regulatorAquifex aeolicus 3.40.50.2300 136 3 50 2.40 4.73
3gt7A00 73.98 Sensor proteinSyntrophus aciditrophicus SB 3.40.50.2300 131 10 50 2.35 4.70
1a04A01 73.52 Two-component systemTwo-component system, NarL family, nitrate/nitrite response regulator NarLProtein bindingEscherichia coli K-12Nitrate/nitrite response regulator protein narL 3.40.50.2300 124 4 53 2.63 4.91
2p2sA01 72.92 Pectobacterium atrosepticumPutative oxidoreductase 3.40.50.720 130 6 62 3.08 4.96
1iibA00 72.04 Phosphotransferase system (PTS)N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIB componentPTS system, cellobiose-specific IIB component [EC:2.7.1.69]Escherichia coli K-12 3.40.50.270 103 6 48 2.35 4.84
[1]
Displaying entries 1 to 17 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bxrA05
PVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGIEFDYCCVHASLALREDGYETIMVNCNP
ETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKPKGVIVQYGGQTPLKLARALEAAGVPVIG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bxrA05
PVYKRVDTCAAEFATDTAYMYSTYEEECEANPSTDREKIMVLGGGPNRIGQGIEFDYCCVHASLALREDGYETIMVNCNP
ETVSTDYDTSDRLYFEPVTLEDVLEIVRIEKPKGVIVQYGGQTPLKLARALEAAGVPVIG
BLAST against CATH

[top]
Domain History Events (41)

Domain assigned by cuff on 15 Feb 2008 15:37

same superfamily

Domain assignment manual match h by tronnberg on 11 Dec 2007 10:16

SSAP: 93.3 OV: 78 SEQ: 100. A small beta sheet difference between the twi structures.

Homcheck review by tronnberg on 11 Dec 2007 10:16

SSAP: 93.3 OV: 78 SEQ: 100. A small beta sheet difference between the twi structures.

Flow stage update by tronnberg on 11 Dec 2007 10:16

SSAP: 93.3 OV: 78 SEQ: 100. A small beta sheet difference between the twi structures.

Homcheck allotment by tronnberg on 11 Dec 2007 10:14

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 11 Dec 2007 10:14

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 09 Dec 2007 15:24

Calculated SCOP results for 1bxrA05 and inserted them into the database.

Domain scan scop cath by auto on 09 Dec 2007 15:23

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 13 results for 1bxrA05

Flow stage update by auto on 09 Dec 2007 06:32

Retrieved PRC_PFAMCATH results for job ID SID4573114324901248 and results inserted.

Domain scan prc pfamcath by auto on 09 Dec 2007 06:32

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 6 results for 1bxrA05

Update comment by auto on 09 Dec 2007 03:24

PRC_PFAMCATH job SID4573114324901248 is not yet finished.

Prc pfamcath submit by auto on 09 Dec 2007 03:21

The entry "1bxrA05" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 09 Dec 2007 03:21

The entry "1bxrA05" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 09 Dec 2007 02:59

Retrieved SSAP results for job ID SID0031497464600288 and results inserted.

Domain scan ssap cath by auto on 09 Dec 2007 02:56

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2191 results for 1bxrA05

Update comment by auto on 08 Dec 2007 03:17

SSAP job SID0031497464600288 is not yet finished.

Flow stage update by auto on 08 Dec 2007 02:55

The entry "1bxrA05" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 08 Dec 2007 02:55

The entry "1bxrA05" has been submitted to the SSAP webservice.

Flow stage update by auto on 08 Dec 2007 02:49

Retrieved PRC results for job ID SID7403896912854220 and inserted them into the database.

Domain scan prc cath by auto on 08 Dec 2007 02:49

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 4 results for 1bxrA05

Update comment by auto on 07 Dec 2007 19:37

PRC job SID7403896912854220 is not yet finished.

Prc cath submit by auto on 07 Dec 2007 19:31

The entry "1bxrA05" has been submitted to the PRC webservice.

Flow stage update by auto on 07 Dec 2007 19:31

The entry "1bxrA05" has been submitted to the PRC webservice.

Flow stage update by auto on 07 Dec 2007 19:25

Retrieved HMM(SAM) results for job ID SID7240098313725728 and inserted them into the database.

Domain scan sam cath by auto on 07 Dec 2007 19:25

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 4 results for 1bxrA05

Update comment by auto on 07 Dec 2007 14:38

HMM(SAM) job SID7240098313725728 is not yet finished.

Sam cath submit by auto on 07 Dec 2007 14:32

The entry "1bxrA05" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 07 Dec 2007 14:32

The entry "1bxrA05" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 07 Dec 2007 14:26

Retrieved "1bxrA05" CATHEDRAL results for job ID SID8277639572062544 and inserted them into the database.

Domain scan cathedral cath by auto on 07 Dec 2007 14:25

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 450 results for 1bxrA05

Update comment by auto on 06 Dec 2007 10:26

"1bxrA05" CATHEDRAL job SID8277639572062544 is not yet finished.

Cathedral cath submit by auto on 06 Dec 2007 10:24

The entry "1bxrA05" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 06 Dec 2007 10:24

The entry "1bxrA05" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 06 Dec 2007 10:23

ScanList with 11651 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1bxrA05.scanlist" for "1bxrA05"

Write scan list by auto on 06 Dec 2007 10:23

Writing ScanList containing 11651 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1bxrA05.scanlist" for domain "1bxrA05"

Flow stage update by auto on 20 Jul 2007 15:42

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Mar 2007 15:07

No in_process hits for Domain "1bxrA05" ready to be processed

Flow stage update by auto on 14 Mar 2007 15:05

NW result present for Domain "1bxrA05"

Flow stage update by auto on 14 Mar 2007 15:01

All required files are present for Domain "1bxrA05"

Flow stage update by auto on 14 Mar 2007 14:59

Beginning processing for Domain "1bxrA05"

Insertion by cuff on 21 Dec 2006 11:59

nice selection of choppings