Set cath from cathlist by auto on 05 Mar 2006 19:32
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1bxkA01 | 1 | 196 |
| 1bxkA01 | 224 | 257 |
| 1bxkA01 | 300 | 321 |
| 1bxkA02 | 197 | 223 |
| 1bxkA02 | 258 | 290 |
| 1bxkA02 | 322 | 350 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.90.25.10.15.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1z7bA02 | 86.01 | 3.90.25.10 | 89 | 13 | 79 | 2.91 | 3.65 | |
![]() |
1n2sA02 | 79.81 | 3.90.25.10 | 85 | 8 | 71 | 3.02 | 4.20 |
>pdb|1bxkA02 PEKLIPLMILNALAGKSLPVYGNGQQIKNLDVVETICELLEELAPNKPHGVAHYRDLITFSGMRKTVQWYLANESWWKQV QDGSYQGER
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"