CATH Domain: 1bx4A02 XML data for domain: 1bx4A02

Molscript image for 1bx4A02
1bx4A02
PDB coordinates for domain 1bx4A02

PDB 1bx4, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1110 Adenosine kinase, small domain
3.30.1110.10 Gene3D
3.30.1110.10.2
3.30.1110.10.2.1
3.30.1110.10.2.1.1
3.30.1110.10.2.1.1.1
3.30.1110.10.2.1.1.1.1

[top]
Segment boundaries for domain 1bx4A02

Chopping figure for domain 1bx4A02
DomainStart PDB ResidueStop PDB Residue
1bx4A01 4 16
1bx4A01 63 120
1bx4A01 138 345
1bx4A02 17 62
1bx4A02 121 137

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1110.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ua4A02 73.87 Pyrococcus furiosusADP-dependent glucokinaseADP-specific glucokinase [EC:2.7.1.147] 3.30.1110.20 112 11 52 2.21 4.20
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bx4A02
LDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGTCAACITGDNRSLIAN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bx4A02
LDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGTCAACITGDNRSLIAN
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:14

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"