CATH Domain: 1bx4A01 XML data for domain: 1bx4A01

Molscript image for 1bx4A01
1bx4A01
PDB coordinates for domain 1bx4A01

PDB 1bx4, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1190 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase
3.40.1190.20 Gene3D
3.40.1190.20.2
3.40.1190.20.2.1
3.40.1190.20.2.1.1
3.40.1190.20.2.1.1.1
3.40.1190.20.2.1.1.1.1

[top]
Segment boundaries for domain 1bx4A01

Chopping figure for domain 1bx4A01
DomainStart PDB ResidueStop PDB Residue
1bx4A01 4 16
1bx4A01 63 120
1bx4A01 138 345
1bx4A02 17 62
1bx4A02 121 137

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.40.1190.20.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2fv7A00 84.04 Pentose phosphate pathwayRibokinaseRibokinase [EC:2.7.1.15]Homo sapiens 3.40.1190.20 308 16 81 2.25 2.77
1v1aA00 84.02 Thermus thermophilus HB82-dehydro-3-deoxygluconokinase [EC:2.7.1.45]Pentose and glucuronate interconversionsPentose phosphate pathway2-keto-3-deoxy-gluconate kinase 3.40.1190.20 301 18 82 2.33 2.82
2qhpA00 83.73 Fructokinase [EC:2.7.1.4]Amino sugar and nucleotide sugar metabolismStarch and sucrose metabolismBacteroides thetaiotaomicronFructokinase 3.40.1190.20 275 16 89 2.59 2.89
1rkdA00 83.42 Pentose phosphate pathwayD-ribose catabolic processRibokinase activityRibokinaseRibokinase [EC:2.7.1.15] 3.40.1190.20 306 22 80 2.26 2.80
1tyyB00 83.35 Amino sugar and nucleotide sugar metabolismStarch and sucrose metabolismFructose and mannose metabolismMetabolic pathwaysFructokinase [EC:2.7.1.4] 3.40.1190.20 292 16 85 2.52 2.96
2qcvA01 83.08 5-dehydro-2-deoxygluconokinase [EC:2.7.1.92]Bacillus haloduransInositol phosphate metabolismMetabolic pathways5-dehydro-2-deoxygluconokinase 3.40.1190.20 262 18 86 2.92 3.38
2nwhA00 82.41 Agrobacterium tumefaciens str. C58Carbohydrate kinase 3.40.1190.20 303 15 81 3.39 4.18
2rbcA00 81.15 Sugar kinaseAgrobacterium tumefaciens str. C58 3.40.1190.20 297 14 81 2.56 3.14
2afbB00 81.06 Thermotoga maritima2-dehydro-3-deoxygluconokinase [EC:2.7.1.45]Pentose phosphate pathwayPentose and glucuronate interconversions2-keto-3-deoxygluconate kinase 3.40.1190.20 319 13 78 2.49 3.16
2abqA00 80.20 Fructose 1-phosphate kinase1-phosphofructokinase [EC:2.7.1.56]Fructose and mannose metabolismBacillus halodurans 3.40.1190.20 302 14 81 3.59 4.43
1vk4A00 79.71 Thermotoga maritimaPutative uncharacterized protein 3.40.1190.20 276 9 86 3.17 3.69
2ajrA01 78.69 Thermotoga maritima1-phosphofructokinase [EC:2.7.1.56]Fructose and mannose metabolismSugar kinase, pfkB family 3.40.1190.20 259 13 86 3.33 3.86
3bf5A01 77.93 Pentose phosphate pathwayRibokinase [EC:2.7.1.15]Thermoplasma acidophilumRibokinase related protein 3.40.1190.20 221 14 75 3.26 4.31
2r3bA01 75.06 YjeF-related proteinEnterococcus faecalis 3.40.1190.20 266 10 79 3.64 4.55
3drwB01 74.94 Pyrococcus horikoshiiADP-specific phosphofructokinaseADP-specific phosphofructokinase [EC:2.7.1.146] 3.40.1190.20 330 8 68 3.27 4.77
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bx4A01
VRENILFGMGNPLGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTLAAANCYKK
EKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETE
AATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFVGGF
LSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bx4A01
MTSVRENILFGMGNPLGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTLAAANC
YKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGN
ETEAATFAREQGFETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQKEIIDTNGAGDAFV
GGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:14

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"