CATH Domain: 1bunB00 XML data for domain: 1bunB00

Molscript image for 1bunB00
1bunB00
PDB coordinates for domain 1bunB00

PDB 1bun, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.410 Factor Xa Inhibitor
4.10.410.10 Factor Xa Inhibitor Gene3D
4.10.410.10.7
4.10.410.10.7.1
4.10.410.10.7.1.1
4.10.410.10.7.1.1.1
4.10.410.10.7.1.1.1.1

[top]
Segment boundaries for domain 1bunB00

Chopping figure for domain 1bunB00
DomainStart PDB ResidueStop PDB Residue
1bunB00 1 61

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 4.10.410.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tocR02 85.35 OrnithodorinOrnithodoros moubata 4.10.410.10 58 24 91 3.00 3.27
1tocR01 83.39 OrnithodorinOrnithodoros moubata 4.10.410.10 52 13 80 2.53 3.15
1bikA00 79.04 Protein homodimerization activityPlasma membraneNegative regulation of JNK cascadeSerine-type endopeptidase inhibitor activityIgA binding 4.10.410.10 110 26 50 1.40 2.75
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1bunB00
RKRHPDCDKPPDTKICQTVVRAFYYKPSAKRCVQFRYGGCNGNGNHFKSDHLCRCECLEYR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1bunB00
RKRHPDCDKPPDTKICQTVVRAFYYKPSAKRCVQFRYGGCNGNGNHFKSDHLCRCECLEYR
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:38

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 16:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"